PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00275.1.g00450.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 234aa    MW: 25146.9 Da    PI: 8.2825
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00275.1.g00450.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.5e-4161137278
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     CqvegC  dl+ akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Zpz_sc00275.1.g00450.1.sm.mkhc  61 CQVEGCGLDLTGAKEYHRKHRVCEAHTKCPRVVVAGHERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 137
                                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.8E-3354122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.2458135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.51E-3959140IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3161134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEWTVPKPAA SPSSPPLLWD WGDSAMPASG SSGEAPARRG GREREGKRAK GEDGGAGEVK  60
CQVEGCGLDL TGAKEYHRKH RVCEAHTKCP RVVVAGHERR FCQQCSRFHA LSEFDQKKRS  120
CRRRLSDHNA RRRKPQPDAF AFASARLPSS LFGPDTSITA SKFDGAPDLQ HALSLLSAGS  180
CGFPDPVQQA SCLIQFSGTS ENSGDLHSSH GGSSALVSCA DEQHTAPQSQ LSYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2751134184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9650001e-111EU965000.1 Zea mays clone 283067 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.17e-93PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ6H5098e-65SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLK3YU037e-93K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m2e-92(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-41squamosa promoter binding protein-like 2